PDB entry 2p3m

View 2p3m on RCSB PDB site
Description: Solution structure of Mj0056
Class: transferase
Keywords: RIFT barrel, phosphotransferase, riboflavin kinase
Deposited on 2007-03-09, released 2007-10-09
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-03, with a file datestamp of 2008-05-30.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin Kinase MJ0056
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0056
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2p3ma1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p3mA (A:)
    mvklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyi
    etedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnl
    kdgdvikilikgdkde