PDB entry 2p33

View 2p33 on RCSB PDB site
Description: Synthesis and SAR of Aminopyrimidines as Novel c-Jun N-Terminal Kinase (JNK) Inhibitors
Class: transferase
Keywords: JNK3 kinase, inhibitor
Deposited on 2007-03-08, released 2007-06-19
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-19, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.253
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-Jun N-terminal kinase 3
    Species: HOMO SAPIENS
    Gene: MAPK10, JNK3, JNK3A, PRKM10
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2p33a1
  • Heterogens: J07, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p33A (A:)
    mgskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsr
    pfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvi
    qmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagts
    fmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvie
    qlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardlls
    kmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliyke
    vmnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p33A (A:)
    dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
    akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglasfmmtpyvvtryy
    rapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkk
    lqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakris
    vddalqhpyinvwyrehtieewkeliykevmn