PDB entry 2p2w

View 2p2w on RCSB PDB site
Description: Crystal structure of citrate synthase from Thermotoga maritima MSB8
Class: transferase
Keywords: TRANSFERASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-07, released 2007-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p2wa_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p2wA (A:)
    miqkglegvkicessicyldgingrlyyrgipveelaekstfeetayflwygklptksel
    eefkrkmadyrelpaealgilyhlpknlhyidvlkiflsihgsmdgndedlrekairvas
    vfptilayyyryskgkelirprkdlshvenfyymmfgernekirllesafillmeqdina
    stfaalviastlsdlyscivgalgalkgplhggasekvppmleeigsedrveefvqkclk
    ekrkimgfghrvyktydpravflkrvlqehfpdsklfriaskleeyivsnkikniypnvd
    lyssvlfeelgfprnmftalfatarvvgwtahvieyvsdnklirptseyvgpmdveyipi
    errdeng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2wA (A:)
    miqkglegvkicessicyldgingrlyyrgipveelaekstfeetayflwygklptksel
    eefkrkmadyrelpaealgilyhlpknlhyidvlkiflsihedlrekairvasvfptila
    yyyryskgkelirprkdlshvenfyymmfgernekirllesafillmeqdinastfaalv
    iastlsdlyscivgalgalkgplhggasekvppmleeigsedrveefvqkclkekrkimg
    fghrvyktydpravflkrvlqehfpdsklfriaskleeyivsnkikniypnvdlyssvlf
    eelgfprnmftalfatarvvgwtahvieyvsdnklirptseyvgpmdveyipierrde