PDB entry 2p2o

View 2p2o on RCSB PDB site
Description: Crystal structure of maltose transacetylase from Geobacillus kaustophilus P2(1) crystal form
Class: transferase
Keywords: GK1921, gka001001921.1, MALTOSE TRANSACETYLASE, GEOBACILLUS KAUSTOPHILUS STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, SOUTHEAST COLLABORATORY FOR STRUCTURAL GENOMICS, SECSG, RIKEN GENOMICS SCIENCES CENTER, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE, RSGI, TRANSFERASE
Deposited on 2007-03-07, released 2007-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose transacetylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GKB08, GK1921
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p2oa_
  • Chain 'B':
    Compound: Maltose transacetylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GKB08, GK1921
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p2ob_
  • Chain 'C':
    Compound: Maltose transacetylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GKB08, GK1921
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p2oc_
  • Chain 'D':
    Compound: Maltose transacetylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GKB08, GK1921
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p2od_
  • Chain 'E':
    Compound: Maltose transacetylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GKB08, GK1921
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p2oe_
  • Chain 'F':
    Compound: Maltose transacetylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GKB08, GK1921
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p2of_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p2oA (A:)
    mksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstger
    lfiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphe
    rnsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakv
    ikwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2oA (A:)
    ksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstgerl
    fiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldpher
    nsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakvi
    kwlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p2oB (B:)
    mksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstger
    lfiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphe
    rnsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakv
    ikwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2oB (B:)
    ksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstgerl
    fiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldpher
    nsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakvi
    kwlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p2oC (C:)
    mksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstger
    lfiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphe
    rnsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakv
    ikwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2oC (C:)
    ksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstgerl
    fiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldpher
    nsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakvi
    kwlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p2oD (D:)
    mksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstger
    lfiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphe
    rnsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakv
    ikwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2oD (D:)
    ksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstgerl
    fiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldpher
    nsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakvi
    kwl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2p2oE (E:)
    mksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstger
    lfiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphe
    rnsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakv
    ikwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2oE (E:)
    ksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstgerl
    fiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldpher
    nsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakvi
    kwlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2p2oF (F:)
    mksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstger
    lfiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphe
    rnsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakv
    ikwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2oF (F:)
    ksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstgerl
    fiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldpher
    nsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakvi
    kwlk