PDB entry 2p2m

View 2p2m on RCSB PDB site
Description: Acetyl-CoA Synthetase, R194A mutation
Class: ligase
Keywords: Adenylate-forming enzymes, Domain Alternation, Acyl-CoA ligase, LIGASE
Deposited on 2007-03-07, released 2007-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-coenzyme A synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: acs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKF6
      • engineered (193)
    Domains in SCOPe 2.07: d2p2ma_
  • Chain 'B':
    Compound: Acetyl-coenzyme A synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: acs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKF6
      • engineered (193)
    Domains in SCOPe 2.07: d2p2mb_
  • Heterogens: PRX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p2mA (A:)
    msqthkhaipaniadrclinpeqyetkykqsindpdtfwgeqgkildwitpyqkvkntsf
    apgnvsikwyedgtlnlaancldrhlqengdrtaiiwegddtsqskhisyrelhrdvcrf
    antlldlgikkgdvvaiympmvpeaavamlacarigavhsvifggfspeavagriidsss
    rlvitadegvragasiplkknvddalknpnvtsvehvivlkrtgsdidwqegrdlwwrdl
    iekaspehqpeamnaedplfilytsgstgkpkgvlhttggylvyaattfkyvfdyhpgdi
    ywctadvgwvtghsyllygplacgattlmfegvpnwptparmcqvvdkhqvnilytapta
    iralmaegdkaiegtdrsslrilgsvgepinpeawewywkkigkekcpvvdtwwqtetgg
    fmitplpgaielkagsatrpffgvqpalvdneghpqegategnlvitdswpgqartlfgd
    herfeqtyfstfknmyfsgdgarrdedgyywitgrvddvlnvsghrlgtaeiesalvahp
    kiaeaavvgiphaikgqaiyayvtlnhgeepspelyaevrnwvrkeigplatpdvlhwtd
    slpktrsgkimrrilrkiaagdtsnlgdtstladpgvveklleekqaiamps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2mA (A:)
    hkhaipaniadrclinpeqyetkykqsindpdtfwgeqgkildwitpyqkvkntsfapgn
    vsikwyedgtlnlaancldrhlqengdrtaiiwegddtsqskhisyrelhrdvcrfantl
    ldlgikkgdvvaiympmvpeaavamlacarigavhsvifggfspeavagriidsssrlvi
    tadegvragasiplkknvddalknpnvtsvehvivlkrtgsdidwqegrdlwwrdlieka
    spehqpeamnaedplfilytsgstgkpkgvlhttggylvyaattfkyvfdyhpgdiywct
    advgwvtghsyllygplacgattlmfegvpnwptparmcqvvdkhqvnilytaptairal
    maegdkaiegtdrsslrilgsvgepinpeawewywkkigkekcpvvdtwwqtetggfmit
    plpgaielkagsatrpffgvqpalvdneghpqegategnlvitdswpgqartlfgdherf
    eqtyfstfknmyfsgdgarrdedgyywitgrvddvlnvsghrlgtaeiesalvahpkiae
    aavvgiphaikgqaiyayvtlnhgeepspelyaevrnwvrkeigplatpdvlhwtdslpk
    trsgkimrrilrkiaagdtsntladpgvveklleekqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p2mB (B:)
    msqthkhaipaniadrclinpeqyetkykqsindpdtfwgeqgkildwitpyqkvkntsf
    apgnvsikwyedgtlnlaancldrhlqengdrtaiiwegddtsqskhisyrelhrdvcrf
    antlldlgikkgdvvaiympmvpeaavamlacarigavhsvifggfspeavagriidsss
    rlvitadegvragasiplkknvddalknpnvtsvehvivlkrtgsdidwqegrdlwwrdl
    iekaspehqpeamnaedplfilytsgstgkpkgvlhttggylvyaattfkyvfdyhpgdi
    ywctadvgwvtghsyllygplacgattlmfegvpnwptparmcqvvdkhqvnilytapta
    iralmaegdkaiegtdrsslrilgsvgepinpeawewywkkigkekcpvvdtwwqtetgg
    fmitplpgaielkagsatrpffgvqpalvdneghpqegategnlvitdswpgqartlfgd
    herfeqtyfstfknmyfsgdgarrdedgyywitgrvddvlnvsghrlgtaeiesalvahp
    kiaeaavvgiphaikgqaiyayvtlnhgeepspelyaevrnwvrkeigplatpdvlhwtd
    slpktrsgkimrrilrkiaagdtsnlgdtstladpgvveklleekqaiamps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p2mB (B:)
    hkhaipaniadrclinpeqyetkykqsindpdtfwgeqgkildwitpyqkvkntsfapgn
    vsikwyedgtlnlaancldrhlqengdrtaiiwegddtsqskhisyrelhrdvcrfantl
    ldlgikkgdvvaiympmvpeaavamlacarigavhsvifggfspeavagriidsssrlvi
    tadegvragasiplkknvddalknpnvtsvehvivlkrtgsdidwqegrdlwwrdlieka
    spehqpeamnaedplfilytsgstgkpkgvlhttggylvyaattfkyvfdyhpgdiywct
    advgwvtghsyllygplacgattlmfegvpnwptparmcqvvdkhqvnilytaptairal
    maegdkaiegtdrsslrilgsvgepinpeawewywkkigkekcpvvdtwwqtetggfmit
    plpgaielkagsatrpffgvqpalvdneghpqegategnlvitdswpgqartlfgdherf
    eqtyfstfknmyfsgdgarrdedgyywitgrvddvlnvsghrlgtaeiesalvahpkiae
    aavvgiphaikgqaiyayvtlnhgeepspelyaevrnwvrkeigplatpdvlhwtdslpk
    trsgkimrrilrkiaagdadpgvveklleekqa