PDB entry 2p24

View 2p24 on RCSB PDB site
Description: I-Au/MBP125-135
Class: immune system
Keywords: MHC, I-Au, immunoglobulin fold, MBP, IMMUNE SYSTEM
Deposited on 2007-03-06, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.211
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, A-U alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Aa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14438 (36-End)
      • expression tag (33-35)
    Domains in SCOPe 2.07: d2p24a1, d2p24a2, d2p24a3
  • Chain 'B':
    Compound: H-2 class II histocompatibility antigen, A-U beta chain
    Species: Mus musculus [TaxId:10090]
    Gene: I-Au
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06344
      • see remark 999 (28-41)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p24A (A:)
    maimaprtlvlllsgalaltqtwagshsrgeddieadhvgsygivvyqspgdigqytfef
    dgdelfyvdldkketiwmlpefaqlrsfdpqgglqniatgkhnlgvltkrsnstpatnea
    pqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrdysfh
    klsyltfipsdddiydckvehwgleepvlkhwepeipapmseltetsgsrlevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p24A (A:)
    ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg
    lqniatgkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'B':
    No sequence available.