PDB entry 2p1y

View 2p1y on RCSB PDB site
Description: 1.B2.D9, a bispecific alpha/beta TCR
Class: immune system
Keywords: TCR, autoimmunity, immunoglobulin fold, diabody, IMMUNE SYSTEM
Deposited on 2007-03-06, released 2008-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bispecific alpha/beta TCR
    Species: Mus musculus [TaxId:10090]
    Gene: Valpha2.3/Vbeta8.2
    Database cross-references and differences (RAF-indexed):
    • PDB 2P1Y (Start-237)
    Domains in SCOPe 2.07: d2p1ya1, d2p1ya2
  • Chain 'C':
    Compound: bispecific alpha/beta TCR
    Species: Mus musculus [TaxId:10090]
    Gene: Valpha2.3/Vbeta8.2
    Database cross-references and differences (RAF-indexed):
    • PDB 2P1Y (Start-237)
    Domains in SCOPe 2.07: d2p1yc1, d2p1yc2
  • Chain 'E':
    Compound: bispecific alpha/beta TCR
    Species: Mus musculus [TaxId:10090]
    Gene: Valpha2.3/Vbeta8.2
    Database cross-references and differences (RAF-indexed):
    • PDB 2P1Y (Start-237)
    Domains in SCOPe 2.07: d2p1ye1, d2p1ye2
  • Chain 'G':
    Compound: bispecific alpha/beta TCR
    Species: Mus musculus [TaxId:10090]
    Gene: Valpha2.3/Vbeta8.2
    Database cross-references and differences (RAF-indexed):
    • PDB 2P1Y (Start-237)
    Domains in SCOPe 2.07: d2p1yg1, d2p1yg2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p1yA (A:)
    mavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqenfslilelatpsqtsvyfcasgdlgqtnerlffghgtklsvlgsaddak
    kdaakkdgqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvs
    dkkedgrftiffnkrekklslhiadsqpgdsatyfcaaidtnaykvifgkgthlhvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p1yA (A:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasgdrlffghgtklsvlgsaddakkdaakkd
    gqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsdkkedgr
    ftiffnkrekklslhiadsqpgdsatyfcaaidtnaykvifgkgthlhvlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p1yC (C:)
    mavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqenfslilelatpsqtsvyfcasgdlgqtnerlffghgtklsvlgsaddak
    kdaakkdgqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvs
    dkkedgrftiffnkrekklslhiadsqpgdsatyfcaaidtnaykvifgkgthlhvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p1yC (C:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasgdrlffghgtklsvlgsaddakkdaakkd
    gqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsdkkedgr
    ftiffnkrekklslhiadsqpgdsatyfcaaidtnaykvifgkgthlhvlp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2p1yE (E:)
    mavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqenfslilelatpsqtsvyfcasgdlgqtnerlffghgtklsvlgsaddak
    kdaakkdgqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvs
    dkkedgrftiffnkrekklslhiadsqpgdsatyfcaaidtnaykvifgkgthlhvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p1yE (E:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasgdrlffghgtklsvlgqvrqspqsltvwe
    getailncsyensafdyfpwyqqfpgegpallisilsvsdkkedgrftiffnkrekklsl
    hiadsqpgdsatyfcaaidtnaykvifgkgthlhvlp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2p1yG (G:)
    mavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
    dgykasrpsqenfslilelatpsqtsvyfcasgdlgqtnerlffghgtklsvlgsaddak
    kdaakkdgqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvs
    dkkedgrftiffnkrekklslhiadsqpgdsatyfcaaidtnaykvifgkgthlhvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p1yG (G:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasgdrlffghgtklsvlgqvrqspqsltvwe
    getailncsyensafdyfpwyqqfpgegpallisilsvsdkkedgrftiffnkrekklsl
    hiadsqpgdsatyfcaaidtnaykvifgkgthlhvlp