PDB entry 2p1h

View 2p1h on RCSB PDB site
Description: Rapid Folding and Unfolding of Apaf-1 CARD
Class: apoptosis
Keywords: Apaf-1, folding, unfolding
Deposited on 2007-03-05, released 2007-05-15
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.239
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Apoptotic protease-activating factor 1
  Species: HOMO SAPIENS
  Gene: APAF1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14727 (2-93)
    • cloning artifact (0-1)
  Domains in SCOP 1.75: d2p1ha1
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2p1hA (A:)
  gsmdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlik
  milkkdndsyvsfynallhegykdlaallhdgip