PDB entry 2p1c

View 2p1c on RCSB PDB site
Description: T. Brucei Farnesyl Diphosphate Synthase Complexed with Bisphosphonate BPH-210
Class: transferase
Keywords: protein-bisphosphonate complex, transferase
Deposited on 2007-03-04, released 2008-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.266
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p1ca_
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p1cb_
  • Heterogens: MG, ACT, GG3, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p1cA (A:)
    mgsshhhhhhssglvprgshmasmpmqmfmqvydeiqmflleelelkfdmdpnrvrylrk
    mmdttclggkynrgltvidvaesllslspnnngeeddgarrkrvlhdacvcgwmieflqa
    hylveddimdnsvtrrgkpcwyrhpdvtvqcaindglllkswthmmamhffadrpflqdl
    lcrfnrvdyttavgqlydvtsmfdsnkldpdvsqptttdfaeftlsnykrivkyktayyt
    yllplvmglivsealptvdmgvteelamlmgeyfqvqddvmdcftpperlgkvgtdiqda
    kcswlavtflakassaqvaefkanygsgdsekvatvrrlyeeadlqgdyvayeaavaeqv
    kelieklrlcspgfaasvetlwgktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p1cA (A:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llsdgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqcai
    ndglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdvs
    qptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmgey
    fqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsekv
    atvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p1cB (B:)
    mgsshhhhhhssglvprgshmasmpmqmfmqvydeiqmflleelelkfdmdpnrvrylrk
    mmdttclggkynrgltvidvaesllslspnnngeeddgarrkrvlhdacvcgwmieflqa
    hylveddimdnsvtrrgkpcwyrhpdvtvqcaindglllkswthmmamhffadrpflqdl
    lcrfnrvdyttavgqlydvtsmfdsnkldpdvsqptttdfaeftlsnykrivkyktayyt
    yllplvmglivsealptvdmgvteelamlmgeyfqvqddvmdcftpperlgkvgtdiqda
    kcswlavtflakassaqvaefkanygsgdsekvatvrrlyeeadlqgdyvayeaavaeqv
    kelieklrlcspgfaasvetlwgktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p1cB (B:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llsdgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqcai
    ndglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdvs
    qptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmgey
    fqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsekv
    atvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk