PDB entry 2oza

View 2oza on RCSB PDB site
Description: Structure of p38alpha complex
Class: signaling protein/transferase
Keywords: serine/threonine kinase, protein-protein complex, p38a, mk2, signaling protein/transferase complex
Deposited on 2007-02-25, released 2007-04-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.239
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ozaa_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ozab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ozaA (A:)
    gshvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarre
    velhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereas
    eimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpc
    ytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqy
    efpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlke
    dkerwedvkeemtsalatmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ozaA (A:)
    glqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwr
    asqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyv
    apevlgpekydkscdmwslgvimyillcgyppfysnhglrirmgqyefpnpewsevseev
    kmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemts
    alatmrvdyeqikikkiedasnplllkrrkka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ozaB (B:)
    mahhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ozaB (B:)
    ptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiiha
    krtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltdd
    hvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglagyvatrwyrapei
    mlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisse
    sarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhd
    pddepvadpydqsfesrdllidewksltydevisfvpppl