PDB entry 2oyt

View 2oyt on RCSB PDB site
Description: Crystal Structure of UNG2/DNA(TM)
Class: hydrolase/DNA
Keywords: Enzyme-DNA complex, UNG2, hydrolase/DNA COMPLEX
Deposited on 2007-02-22, released 2007-10-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: UNG, DGU, UNG1, UNG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13051 (3-222)
      • expression tag (0-2)
    Domains in SCOPe 2.02: d2oyta_
  • Chain 'B':
    Compound: DNA strand1
  • Chain 'C':
    Compound: DNA strand2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oytA (A:)
    meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
    lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
    llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
    hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.