PDB entry 2oyp

View 2oyp on RCSB PDB site
Description: T Cell Immunoglobulin Mucin-3 Crystal Structure Revealed a Galectin-9-independent Binding Surface
Class: signaling protein
Keywords: TIM-3; T-cell Immunoglobulin Mucin, SIGNALING PROTEIN
Deposited on 2007-02-22, released 2007-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.158
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatitis A virus cellular receptor 2
    Species: Mus musculus [TaxId:10090]
    Gene: Havcr2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3KP82 (1-108)
      • expression tag (0)
    Domains in SCOPe 2.06: d2oypa1, d2oypa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oypA (A:)
    mdgykvevgknaylpcsytlptsgtlvpmcwgkgfcpwsqctnellrtdernvtyqkssr
    yqlkgdlnkgdvsliiknvtlddhgtyccriqfpglmndkklelkldik