PDB entry 2oyp

View 2oyp on RCSB PDB site
Description: T Cell Immunoglobulin Mucin-3 Crystal Structure Revealed a Galectin-9-independent Binding Surface
Class: signaling protein
Keywords: TIM-3; T-cell Immunoglobulin Mucin, SIGNALING PROTEIN
Deposited on 2007-02-22, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hepatitis A virus cellular receptor 2
  Species: Mus musculus [TaxId:10090]
  Gene: Havcr2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3KP82 (1-108)
    • expression tag (0)
  Domains in SCOPe 2.08: d2oypa1, d2oypa2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oypA (A:)
  mdgykvevgknaylpcsytlptsgtlvpmcwgkgfcpwsqctnellrtdernvtyqkssr
  yqlkgdlnkgdvsliiknvtlddhgtyccriqfpglmndkklelkldik