PDB entry 2oyn

View 2oyn on RCSB PDB site
Description: Crystal structure of CDP-bound protein MJ0056 from Methanococcus jannaschii, Pfam DUF120
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2007-02-22, released 2007-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein MJ0056
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ0056
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60365 (3-137)
      • cloning artifact (1-2)
    Domains in SCOPe 2.05: d2oyna1
  • Heterogens: NA, CDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oynA (A:)
    mslvklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfk
    yietedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqf
    nlkdgdvikilikgdkdeeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oynA (A:)
    slvklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfky
    ietedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfn
    lkdgdvikilikgdkde