PDB entry 2oxh
View 2oxh on RCSB PDB site
Description: The SOXYZ Complex of Paracoccus Pantotrophus
Class: transport protein
Keywords: immunoglobulin-like beta-sandwich fold, transport protein
Deposited on
2007-02-20, released
2007-05-22
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.197
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: SoxZ protein
Species: Paracoccus denitrificans [TaxId:266]
Gene: soxZ
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2oxha_ - Chain 'B':
Compound: SoxY protein
Species: Paracoccus denitrificans [TaxId:266]
Gene: soxY
Database cross-references and differences (RAF-indexed):
- Uniprot Q9LCU9 (11-123)
- expression tag (9)
- cloning artifact (10-11)
- modified residue (121)
- Chain 'C':
Compound: SoxZ protein
Species: Paracoccus denitrificans [TaxId:266]
Gene: soxZ
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2oxhc_ - Chain 'D':
Compound: SoxY protein
Species: Paracoccus denitrificans [TaxId:266]
Gene: soxY
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: SoxZ protein
Species: Paracoccus denitrificans [TaxId:266]
Gene: soxZ
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2oxhe_ - Chain 'F':
Compound: SoxY protein
Species: Paracoccus denitrificans [TaxId:266]
Gene: soxY
Database cross-references and differences (RAF-indexed):
- Uniprot Q9LCU9 (11-123)
- cloning artifact (10-11)
- modified residue (121)
- Chain 'Y':
Compound: SoxY protein
Species: Paracoccus denitrificans [TaxId:266]
Gene: soxY
Database cross-references and differences (RAF-indexed):
- Uniprot Q9LCU9 (11-End)
- cloning artifact (11)
- modified residue (121)
- Chain 'Z':
Compound: SoxZ protein
Species: Paracoccus denitrificans [TaxId:266]
Gene: soxZ
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2oxhz_ - Heterogens: EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2oxhA (A:)
addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2oxhC (C:)
addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>2oxhE (E:)
addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
- Chain 'F':
No sequence available.
- Chain 'Y':
No sequence available.
- Chain 'Z':
Sequence; same for both SEQRES and ATOM records: (download)
>2oxhZ (Z:)
addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav