PDB entry 2oxc

View 2oxc on RCSB PDB site
Description: Human DEAD-box RNA helicase DDX20, DEAD domain in complex with ADP
Class: hydrolase
Keywords: RNA, helicase, dead, structural genomics, structural genomics consortium, sgc, hydrolase
Deposited on 2007-02-20, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX20
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX20, DP103, GEMIN3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oxca_
  • Chain 'B':
    Compound: Probable ATP-dependent RNA helicase DDX20
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX20, DP103, GEMIN3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oxcb_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oxcA (A:)
    smrtaqdlssprtrtgdvllaepadfeslllsrpvleglraagferpspvqlkaiplgrc
    gldlivqaksgtgktcvfstialdslvlenlstqililaptreiavqihsvitaigikme
    glechvfiggtplsqdktrlkkchiavgspgrikqlieldylnpgsirlfildeadklle
    egsfqeqinwiysslpaskqmlavsatypeflanaltkymrdptfvrlns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oxcA (A:)
    adfeslllsrpvleglraagferpspvqlkaiplgrcgldlivqaksgtgktcvfstial
    dslvlenlstqililaptreiavqihsvitaigikmeglechvfiggtplsqdktrlkkc
    hiavgspgrikqlieldylnpgsirlfildeadklleegsfqeqinwiysslpaskqmla
    vsatypeflanaltkymrdptfvrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oxcB (B:)
    smrtaqdlssprtrtgdvllaepadfeslllsrpvleglraagferpspvqlkaiplgrc
    gldlivqaksgtgktcvfstialdslvlenlstqililaptreiavqihsvitaigikme
    glechvfiggtplsqdktrlkkchiavgspgrikqlieldylnpgsirlfildeadklle
    egsfqeqinwiysslpaskqmlavsatypeflanaltkymrdptfvrlns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oxcB (B:)
    adfeslllsrpvleglraagferpspvqlkaiplgrcgldlivqaksgtgktcvfstial
    dslvlenlstqililaptreiavqihsvitaigikmeglechvfiggtplsqdktrlkkc
    hiavgspgrikqlieldylnpgsirlfildeadklleegsfqeqinwiysslpaskqmla
    vsatypeflanaltkymrdptfvrl