PDB entry 2ox8

View 2ox8 on RCSB PDB site
Description: Human Scavenger Receptor C-type Lectin carbohydrate-recognition domain.
Class: sugar binding protein
Keywords: c-type lectin, SUGAR BINDING PROTEIN
Deposited on 2007-02-20, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Scavenger receptor with C-type lectin type I
    Species: Homo sapiens [TaxId:9606]
    Gene: SRCL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox8a_
  • Chain 'B':
    Compound: Scavenger receptor with C-type lectin type I
    Species: Homo sapiens [TaxId:9606]
    Gene: SRCL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox8b_
  • Chain 'C':
    Compound: Scavenger receptor with C-type lectin type I
    Species: Homo sapiens [TaxId:9606]
    Gene: SRCL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox8c_
  • Chain 'D':
    Compound: Scavenger receptor with C-type lectin type I
    Species: Homo sapiens [TaxId:9606]
    Gene: SRCL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox8d_
  • Heterogens: ZN, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ox8A (A:)
    ednscpphwknftdkcyyfsvekeifedaklfcedksshlvfintreeqqwikkqmvgre
    shwigltdserenewkwldgtspdyknwkagqpdnwghghgpgedcagliyagqwndfqc
    edvnnficekdretvlssal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox8A (A:)
    scpphwknftdkcyyfsvekeifedaklfcedksshlvfintreeqqwikkqmvgreshw
    igltdserenewkwldgtspdyknwkagqpdnwghghgpgedcagliyagqwndfqcedv
    nnficekdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ox8B (B:)
    ednscpphwknftdkcyyfsvekeifedaklfcedksshlvfintreeqqwikkqmvgre
    shwigltdserenewkwldgtspdyknwkagqpdnwghghgpgedcagliyagqwndfqc
    edvnnficekdretvlssal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox8B (B:)
    scpphwknftdkcyyfsvekeifedaklfcedksshlvfintreeqqwikkqmvgreshw
    igltdserenewkwldgtspdyknwkagqpdnwghghgpgedcagliyagqwndfqcedv
    nnficekdr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ox8C (C:)
    ednscpphwknftdkcyyfsvekeifedaklfcedksshlvfintreeqqwikkqmvgre
    shwigltdserenewkwldgtspdyknwkagqpdnwghghgpgedcagliyagqwndfqc
    edvnnficekdretvlssal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox8C (C:)
    scpphwknftdkcyyfsvekeifedaklfcedksshlvfintreeqqwikkqmvgreshw
    igltdserenewkwldgtspdyknwkagqpdnwghghgpgedcagliyagqwndfqcedv
    nnficekdr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ox8D (D:)
    ednscpphwknftdkcyyfsvekeifedaklfcedksshlvfintreeqqwikkqmvgre
    shwigltdserenewkwldgtspdyknwkagqpdnwghghgpgedcagliyagqwndfqc
    edvnnficekdretvlssal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox8D (D:)
    scpphwknftdkcyyfsvekeifedaklfcedksshlvfintreeqqwikkqmvgreshw
    igltdserenewkwldgtspdyknwkagqpdnwghghgpgedcagliyagqwndfqcedv
    nnficekdr