PDB entry 2ox6

View 2ox6 on RCSB PDB site
Description: Crystal structure of gene product SO3848 from Shewanella oneidensis MR-1
Class: structural genomics, unknown function
Keywords: Shewanella oneidensis, Structural genomics, PSI-2, MCSG, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2007-02-19, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.201
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein SO3848
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_3848
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox6a1
  • Chain 'B':
    Compound: Hypothetical protein SO3848
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_3848
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox6b_
  • Chain 'C':
    Compound: Hypothetical protein SO3848
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_3848
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox6c_
  • Chain 'D':
    Compound: Hypothetical protein SO3848
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_3848
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox6d_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ox6A (A:)
    mskniglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldidd
    iiemqvlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawri
    kkecklvlevdvslinlnveaykayreqnglsesresrakwaatql
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox6A (A:)
    iglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldiddiiem
    qvlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawrikkec
    klvlevdvslinlnveaykayreqnglsesresrakwaatql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ox6B (B:)
    mskniglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldidd
    iiemqvlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawri
    kkecklvlevdvslinlnveaykayreqnglsesresrakwaatql
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox6B (B:)
    iglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldiddiiem
    qvlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawrikkec
    klvlevdvslinlnveaykayreqnglsesresrakwaatql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ox6C (C:)
    mskniglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldidd
    iiemqvlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawri
    kkecklvlevdvslinlnveaykayreqnglsesresrakwaatql
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox6C (C:)
    niglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldiddiie
    mqvlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawrikke
    cklvlevdvslinlnveaykayreqnglsesresrakwaatql
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ox6D (D:)
    mskniglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldidd
    iiemqvlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawri
    kkecklvlevdvslinlnveaykayreqnglsesresrakwaatql
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox6D (D:)
    glnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldiddiiemq
    vlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawrikkeck
    lvlevdvslinlnveaykayreqnglsesresrakwaatql