PDB entry 2ox5

View 2ox5 on RCSB PDB site
Description: The SoxYZ complex of Paracoccus pantotrophus
Class: Transport Protein
Keywords: IMMUNOGLOBULIN-LIKE BETA-SANDWICH FOLD, Transport Protein
Deposited on 2007-02-19, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox5a_
  • Chain 'B':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9 (3-End)
      • expression tag (2)
  • Chain 'C':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox5c_
  • Chain 'D':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9 (3-End)
      • expression tag (1-2)
      • expression tag (2)
      • expression tag (1-2)
  • Chain 'E':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox5e_
  • Chain 'F':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9 (3-End)
      • expression tag (0-1)
      • expression tag (1-2)
      • expression tag (0-2)
  • Chain 'Y':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9 (3-114)
      • expression tag (2)
      • expression tag (2)
      • expression tag (2)
  • Chain 'Z':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox5z_
  • Heterogens: ACT, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ox5A (A:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ox5C (C:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox5C (C:)
    addakprvkvpssakagetvtvkalishkmesgqrkliprsiinrftcelngvnvvdvai
    dpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ox5E (E:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox5E (E:)
    addakprvkvpssakagetvtvkalishkmesgqliprsiinrftcelngvnvvdvaidp
    avstnpyfefdakvdaagefkftwydddgsvyedvkpiava
    

  • Chain 'F':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ox5Z (Z:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava