PDB entry 2owj

View 2owj on RCSB PDB site
Description: Structure of an early-microsecond photolyzed state of CO-bjFixLH, dark state
Class: oxygen storage/transport
Keywords: PAS domain, oxygen sensor, heme, Laue diffraction, time-resolved crystallography, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2007-02-16, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor protein fixl
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Gene: fixL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2owja_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2owjA (A:)
damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel