PDB entry 2ovr

View 2ovr on RCSB PDB site
Description: Structure of the Skp1-Fbw7-CyclinEdegN complex
Class: transcription/cell cycle
Keywords: F-box; WD40 domains; double phosphorylation
Deposited on 2007-02-14, released 2007-04-24
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-phase kinase-associated protein 1A
    Species: HOMO SAPIENS
    Gene: SKP1A, EMC19, OCP2, SKP1, TCEB1L
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ovra1, d2ovra2
  • Chain 'B':
    Compound: F-box/WD repeat protein 7
    Species: HOMO SAPIENS
    Gene: FBXW7, FBW7, FBX30, SEL10
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: cyclinE N-terminal degron
    Species: synthetic, synthetic
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ovrA (A:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovrA (A:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhdd
    ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
    fteeeeaqvrkenqwc
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.