PDB entry 2ovk

View 2ovk on RCSB PDB site
Description: Crystal structure of Rigor-like Squid Myosin S1
Class: contractile protein
Keywords: rigor-like, squid, muscle myosin, CONTRACTILE PROTEIN
Deposited on 2007-02-14, released 2007-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.238
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin heavy chain isoform A
    Species: Loligo pealei [TaxId:6621]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Myosin regulatory light chain LC-2, mantle muscle
    Species: Todarodes pacificus [TaxId:6637]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ovkb_
  • Chain 'C':
    Compound: Myosin catalytic light chain LC-1, mantle muscle
    Species: Todarodes pacificus [TaxId:6637]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ovkc_
  • Heterogens: CA, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ovkB (B:)
    aeeaprrvklsqrqmqelkeaftmidqdrdgfigmedlkdmfsslgrvppddelnamlke
    cpgqlnftafltlfgekvsgtdpedalrnafsmfdedgqgfipedylkdllenmgdnfsk
    eeiknvwkdaplknkqfnynkmvdikgkaeded
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovkB (B:)
    rvklsqrqmqelkeaftmidqdrdgfigmedlkdmfsslgrvppddelnamlkecpgqln
    ftafltlfgekvsgtdpedalrnafsmfdedgqgfipedylkdllenmgdnfskeeiknv
    wkdaplknkqfnynkmvdikgkaed
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ovkC (C:)
    sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge
    kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite
    dqcndiftfcdiredidgnikyedlmkkvmagpfpdksd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovkC (C:)
    sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge
    kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite
    dqcndiftfcdiredidgnikyedlmkkvmagpfpd