PDB entry 2ovb

View 2ovb on RCSB PDB site
Description: Crystal Structure of StaL-sulfate complex
Class: Structural Genomics, Unknown Function
Keywords: StaL sulfate complex, sulfotransferase, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Unknown Function
Deposited on 2007-02-13, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: StaL
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: stal
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLM3 (21-End)
      • cloning artifact (20)
    Domains in SCOPe 2.07: d2ovba1, d2ovba2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ovbA (A:)
    mgsshhhhhhssglvprgshmmcwiasypkagghwlrcmltsyvtgepvetwpgiqagvp
    hlegllrdgeapsadpdeqvllathftadrpvlrfyrestakvvclirnprdamlslmrm
    kgippedveacrkiaetfiadegfssvriwagegswpenirswtdsvhesfpnaavlavr
    yedlrkdpegelwkvvdflelggrdgvadavanctlermremeerskllglettglmtrg
    gkqlpfvgkggqrkslkfmgddiekayadllhgetdfahyarlygyae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovbA (A:)
    mmcwiasypkagghwlrcmltsyvtgepvetwpgiqagvphlegllrdgeapsadpdeqv
    llathftadrpvlrfyrestakvvclirnprdamlslmrmkgippedveacrkiaetfia
    degfssvriwagegswpenirswtdsvhesfpnaavlavryedlrkdpegelwkvvdfle
    lggrdgvadavanctlermremeerskllglettkslkfmgddiekayadllhgetdfah
    yarlygya