PDB entry 2ov2

View 2ov2 on RCSB PDB site
Description: The crystal structure of the human RAC3 in complex with the CRIB domain of human p21-activated kinase 4 (PAK4)
Class: protein binding/transferase
Keywords: GTPase RAC3, small GTP binding protein, p21 rac, ras-related C3 botulinum toxin substrate 3, signalling protein, CRIB, kinase, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN BINDING-TRANSFERASE COMPLEX
Deposited on 2007-02-12, released 2007-03-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.174
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-177)
      • cloning artifact (178)
    Domains in SCOPe 2.05: d2ov2a_
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-177)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d2ov2b_
  • Chain 'C':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-177)
      • cloning artifact (178)
    Domains in SCOPe 2.05: d2ov2c_
  • Chain 'D':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-177)
      • cloning artifact (0)
      • cloning artifact (178)
    Domains in SCOPe 2.05: d2ov2d_
  • Chain 'E':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (Start-177)
      • cloning artifact (178)
    Domains in SCOPe 2.05: d2ov2e_
  • Chain 'F':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-177)
      • cloning artifact (0)
      • cloning artifact (178)
    Domains in SCOPe 2.05: d2ov2f_
  • Chain 'G':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-177)
      • cloning artifact (178)
    Domains in SCOPe 2.05: d2ov2g_
  • Chain 'H':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-177)
      • cloning artifact (0)
      • cloning artifact (178)
    Domains in SCOPe 2.05: d2ov2h_
  • Chain 'I':
    Compound: serine/threonine-protein kinase pak 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK4, KIAA1142
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: serine/threonine-protein kinase pak 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK4, KIAA1142
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: serine/threonine-protein kinase pak 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK4, KIAA1142
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: serine/threonine-protein kinase pak 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK4, KIAA1142
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: serine/threonine-protein kinase pak 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK4, KIAA1142
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: serine/threonine-protein kinase pak 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK4, KIAA1142
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: serine/threonine-protein kinase pak 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK4, KIAA1142
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: serine/threonine-protein kinase pak 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK4, KIAA1142
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, CL, GCP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ov2A (A:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ov2A (A:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
    ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ov2B (B:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ov2B (B:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ov2C (C:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ov2C (C:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
    ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ov2D (D:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ov2E (E:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ov2E (E:)
    qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagq
    edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrd
    dkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ov2F (F:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ov2G (G:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ov2G (G:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
    ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ov2H (H:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ov2H (H:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rdddtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.