PDB entry 2ov0

View 2ov0 on RCSB PDB site
Description: Structure of the blue copper protein Amicyanin to 0.75 A resolution
Class: electron transport
Keywords: beta-sandwich, ELECTRON TRANSPORT
Deposited on 2007-02-12, released 2007-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 0.75 Å
R-factor: N/A
AEROSPACI score: 1.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amicyanin
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: mauC, ami
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22364 (0-104)
  Domains in SCOPe 2.08: d2ov0a_
• Heterogens: CU, PO4, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ov0A (A:)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve