PDB entry 2ouz

View 2ouz on RCSB PDB site
Description: Crystal Structure of Estrogen Receptor alpha-lasofoxifene complex
Class: hormone/growth factor
Keywords: Nuclear receptor, SERM, estrogen
Deposited on 2007-02-12, released 2007-05-08
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ouza1
  • Heterogens: C3D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ouzA (A:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ouzA (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemld
    ahrlha