PDB entry 2ouk

View 2ouk on RCSB PDB site
Description: ABC Protein ArtP in complex with Sulphate
Class: hydrolase
Keywords: ABC Domain; ATPase, HYDROLASE
Deposited on 2007-02-11, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein ArtP
    Species: Geobacillus Stearothermophilus [TaxId:1422]
    Gene: artP
    Database cross-references and differences (RAF-indexed):
    • PDB 2OUK (Start-262)
    Domains in SCOPe 2.07: d2ouka1, d2ouka2
  • Chain 'B':
    Compound: protein ArtP
    Species: Geobacillus Stearothermophilus [TaxId:1422]
    Gene: artP
    Database cross-references and differences (RAF-indexed):
    • PDB 2OUK (Start-262)
    Domains in SCOPe 2.07: d2oukb_
  • Chain 'C':
    Compound: protein ArtP
    Species: Geobacillus Stearothermophilus [TaxId:1422]
    Gene: artP
    Database cross-references and differences (RAF-indexed):
    • PDB 2OUK (Start-262)
    Domains in SCOPe 2.07: d2oukc1, d2oukc2
  • Chain 'D':
    Compound: protein ArtP
    Species: Geobacillus Stearothermophilus [TaxId:1422]
    Gene: artP
    Database cross-references and differences (RAF-indexed):
    • PDB 2OUK (Start-262)
    Domains in SCOPe 2.07: d2oukd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oukA (A:)
    mgsshhhhhhssglvprgshmlqmidvhqlkksfgslevlkginvhiregevvvvigpsg
    sgkstflrclnlledfdegeiiidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnn
    itlapmkvrkwprekaeakamelldkvglkdkahaypdslsggqaqrvaiaralamepki
    mlfdeptsaldpemvgevlsvmkqlanegmtmvvvthemgfarevgdrvlfmdggyiiee
    gkpedlfdrpqhertkaflskvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oukA (A:)
    lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei
    iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam
    elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv
    mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk
    vf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oukB (B:)
    mgsshhhhhhssglvprgshmlqmidvhqlkksfgslevlkginvhiregevvvvigpsg
    sgkstflrclnlledfdegeiiidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnn
    itlapmkvrkwprekaeakamelldkvglkdkahaypdslsggqaqrvaiaralamepki
    mlfdeptsaldpemvgevlsvmkqlanegmtmvvvthemgfarevgdrvlfmdggyiiee
    gkpedlfdrpqhertkaflskvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oukB (B:)
    qmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegeii
    idginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakame
    lldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsvm
    kqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflskv
    f
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oukC (C:)
    mgsshhhhhhssglvprgshmlqmidvhqlkksfgslevlkginvhiregevvvvigpsg
    sgkstflrclnlledfdegeiiidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnn
    itlapmkvrkwprekaeakamelldkvglkdkahaypdslsggqaqrvaiaralamepki
    mlfdeptsaldpemvgevlsvmkqlanegmtmvvvthemgfarevgdrvlfmdggyiiee
    gkpedlfdrpqhertkaflskvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oukC (C:)
    lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei
    iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam
    elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv
    mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk
    vf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2oukD (D:)
    mgsshhhhhhssglvprgshmlqmidvhqlkksfgslevlkginvhiregevvvvigpsg
    sgkstflrclnlledfdegeiiidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnn
    itlapmkvrkwprekaeakamelldkvglkdkahaypdslsggqaqrvaiaralamepki
    mlfdeptsaldpemvgevlsvmkqlanegmtmvvvthemgfarevgdrvlfmdggyiiee
    gkpedlfdrpqhertkaflskvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oukD (D:)
    qmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegeii
    idginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakame
    lldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsvm
    kqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflskv
    f