PDB entry 2otg

View 2otg on RCSB PDB site
Description: Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
Class: contractile protein
Keywords: Myosin S1, motor, rigor-like, CONTRACTILE PROTEIN
Deposited on 2007-02-08, released 2007-05-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: 0.276
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain
    Species: Placopecten magellanicus [TaxId:6577]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: myosin regulatory light chain
    Species: Placopecten magellanicus [TaxId:6577]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2otgb_
  • Chain 'C':
    Compound: myosin essential light chain
    Species: Placopecten magellanicus [TaxId:6577]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2otgc_
  • Heterogens: MG, CA, ADP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2otgB (B:)
    madkaasgvltklpqkqiqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltam
    lkeapgplnftmflsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdn
    fnkdemrmtfkeapveggkfdyvrfvamikgsgddda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2otgB (B:)
    pqkqiqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapgplnftmf
    lsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdemrmtfkea
    pveggkfdyvrfvamikgsgd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2otgC (C:)
    mpklsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmg
    ekslpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsd
    eevdeiinltdlqedlegnvkyeefvkkvmtgpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2otgC (C:)
    pklsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsde
    evdeiinltdlqedlegnvkyeefvkkvmtgpypd