PDB entry 2ot6

View 2ot6 on RCSB PDB site
Description: Crystal Structure of a Bowman-Birk Inhibitor from Vigna Unguiculata Seeds
Class: Plant Protein
Keywords: BOWMAN-BIRK PROTEASE INHIBITOR,VIGNA UNGUICULATA,PLANT-PIs, Protein-Protein Interactions, Plant Protein
Deposited on 2007-02-07, released 2007-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2007-11-27, with a file datestamp of 2007-11-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin inhibitor
    Species: Vigna sinensis
    Domains in SCOPe 2.08: d2ot6a_
  • Chain 'B':
    Compound: trypsin inhibitor
    Species: Vigna sinensis
    Domains in SCOPe 2.08: d2ot6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ot6A (A:)
essepccdscvctksippqchctnirlnschsgcksclctasapgscrcldianfcykpc
kp

    Sequence, based on observed residues (ATOM records): (download) 
    >2ot6A (A:)
pccdscvctksippqchctnirlnschsgcksclctasgscrcldianfcykpck

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ot6B (B:)
essepccdscvctksippqchctnirlnschsgcksclctasapgscrcldianfcykpc
kp

    Sequence, based on observed residues (ATOM records): (download) 
    >2ot6B (B:)
pccdscvctksippqchctnirlnschsgcksclctasapgscrcldianfcykpck