PDB entry 2ot3

View 2ot3 on RCSB PDB site
Description: Crystal structure of rabex-5 VPS9 domain in complex with nucleotide free RAB21
Class: protein transport
Keywords: Rabex-5, Vps9 Domain, Rab21, vesicular traffic, protein transport
Deposited on 2007-02-07, released 2007-04-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rab5 GDP/GTP exchange factor
    Species: Homo sapiens [TaxId:9606]
    Gene: RABGEF1, RABEX5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ot3a_
  • Chain 'B':
    Compound: Ras-related protein Rab-21
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB21, KIAA0118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ot3b1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ot3A (A:)
    gshhhhhhsietdrvskefieflktfhktgqeiykqtklflegmhykrdlsieeqsecaq
    dfyhnvaermqtrgkvppervekimdqiekyimtrlykyvfcpettddekkdlaiqkrir
    alrwvtpqmlcvpvnedipevsdmvvkaitdiiemdskrvprdklacitkcskhifnaik
    itknepasaddflptliyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlccav
    afiekldaqslnlsqedfdrymsgqtsprkqeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ot3A (A:)
    skefieflktfhktgqeiykqtklflegmhykrdlsieeqsecaqdfyhnvaermqtrgk
    vppervekimdqiekyimtrlykyvfcpettddekkdlaiqkriralrwvtpqmlcvpvn
    edipevsdmvvkaitdiiemdskrvprdklacitkcskhifnaikitknepasaddflpt
    liyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlccavafiekldaqslnlsq
    edfdrymsgqtsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ot3B (B:)
    gsraysfkvvllgegcvgktslvlrycenkfndkhittlqasfltkklniggkrvnlaiw
    dtagqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnk
    idlekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ot3B (B:)
    aysfkvvllgegcvgktslvlrycttlqasfltkklniggkrvnlaiwdtagqerfhalg
    piyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvsiq
    eaesyaesvgakhyhtsakqnkgieelfldlckrmie