PDB entry 2osv

View 2osv on RCSB PDB site
Description: Crystal Structure of ZnuA from E. coli
Class: metal transport
Keywords: protein-zinc complex, METAL TRANSPORT
Deposited on 2007-02-06, released 2007-04-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High-affinity zinc uptake system protein znuA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: High-affinity zinc uptake system protein znuA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2osvb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2osvB (B:)
    avvaslkpvgfiasaiadgvtetevllpdgasehdyslrpsdvkrlqnadlvvwvgpeme
    afmqkpvsklpgakqvtiaqledvkpllmksihgddddhdhaeksdedhhhgdfnmhlwl
    speiaratavaihgklvelmpqsrakldanlkdfeaqlastetqvgnelaplkgkgyfvf
    hdaygyfekqfgltplghftvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavves
    vargtsvrmgtldplgtniklgktsyseflsqlanqyasclkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2osvB (B:)
    avvaslkpvgfiasaiadgvtetevllpdgasehdyslrpsdvkrlqnadlvvwvgpeme
    afmqkpvsklpgakqvtiaqledvkpllmksidfnmhlwlspeiaratavaihgklvelm
    pqsrakldanlkdfeaqlastetqvgnelaplkgkgyfvfhdaygyfekqfgltplghft
    vnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavvesvargtsvrmgtldplgtnik
    lgktsyseflsqlanqyasclkg