PDB entry 2osp

View 2osp on RCSB PDB site
Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
Class: immune system
Keywords: ospa, lyme disease, antibody fab fragment, neutralizing epitope
Deposited on 1999-02-22, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-10-11, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.236
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hybridoma antibody la2 (light chain))
    Species: MUS MUSCULUS
    Domains in SCOPe 2.07: d2ospa1, d2ospa2
  • Chain 'B':
    Compound: protein (hybridoma antibody la2 (heavy chain))
    Species: MUS MUSCULUS
  • Chain 'C':
    Compound: protein (hybridoma antibody la2 (light chain))
    Species: MUS MUSCULUS
    Domains in SCOPe 2.07: d2ospc1, d2ospc2
  • Chain 'D':
    Compound: protein (hybridoma antibody la2 (heavy chain))
    Species: MUS MUSCULUS
  • Chain 'E':
    Compound: protein (outer surface protein a)
    Species: Borrelia burgdorferi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14013 (Start-256)
      • variant (22)
      • engineered (67)
      • variant (132)
      • variant (147)
    Domains in SCOPe 2.07: d2ospe_
  • Chain 'F':
    Compound: protein (outer surface protein a)
    Species: Borrelia burgdorferi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14013 (Start-256)
      • variant (22)
      • engineered (67)
      • variant (132)
      • variant (147)
    Domains in SCOPe 2.07: d2ospf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ospA (A:)
    diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps
    rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvdwkidgserqngvlnswtdqdskdstysmsstlt
    lskadyerhnsyaceathktstspvvksfnrnex
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ospC (C:)
    diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps
    rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvdwkidgserqngvlnswtdqdskdstysmsstlt
    lskadyerhnsyaceathktstspvvksfnrnex
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ospE (E:)
    akqnvssldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvl
    egvkadkckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevseki
    itradgtrleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksge
    vsvelndtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtkle
    gsaveitkldeiknalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ospE (E:)
    sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
    kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
    trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
    dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
    tkldeiknalk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ospF (F:)
    akqnvssldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvl
    egvkadkckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevseki
    itradgtrleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksge
    vsvelndtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtkle
    gsaveitkldeiknalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ospF (F:)
    sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
    kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
    trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
    dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
    tkldeiknalk