PDB entry 2osl

View 2osl on RCSB PDB site
Description: Crystal structure of Rituximab Fab in complex with an epitope peptide
Class: Immune System
Keywords: Fab-peptide complex, Rituximab, chimeric antibody, Immune System
Deposited on 2007-02-06, released 2007-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heavy chain of the Rituximab Fab fragment
    Species: , [TaxId:9606,10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OSL (0-End)
  • Chain 'B':
    Compound: light chain of the Rituximab Fab fragment
    Species: , [TaxId:9606,10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OSL (0-212)
    Domains in SCOPe 2.06: d2oslb1, d2oslb2
  • Chain 'H':
    Compound: heavy chain of the Rituximab Fab fragment
    Species: , [TaxId:9606,10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OSL (0-223)
  • Chain 'L':
    Compound: light chain of the Rituximab Fab fragment
    Species: , [TaxId:9606,10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OSL (0-212)
    Domains in SCOPe 2.06: d2osll1, d2osll2
  • Chain 'P':
    Compound: B-lymphocyte antigen CD20
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: B-lymphocyte antigen CD20
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oslB (B:)
    qivlsqspailsaspgekvtmtcrasssvsyihwfqqkpgsspkpwiyatsnlasgvpvr
    fsgsgsgtsysltisrveaedaatyycqqwtsnpptfgggtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oslL (L:)
    qivlsqspailsaspgekvtmtcrasssvsyihwfqqkpgsspkpwiyatsnlasgvpvr
    fsgsgsgtsysltisrveaedaatyycqqwtsnpptfgggtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.