PDB entry 2osl
View 2osl on RCSB PDB site
Description: Crystal structure of Rituximab Fab in complex with an epitope peptide
Class: Immune System
Keywords: Fab-peptide complex, Rituximab, chimeric antibody
Deposited on
2007-02-06, released
2007-04-10
The last revision prior to the SCOP 1.75 freeze date was dated
2007-06-26, with a file datestamp of
2007-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: heavy chain of the Rituximab Fab fragment
Species: homo sapiens, mus musculus
- Chain 'B':
Compound: light chain of the Rituximab Fab fragment
Species: homo sapiens, mus musculus
Domains in SCOP 1.75: d2oslb1, d2oslb2 - Chain 'H':
Compound: heavy chain of the Rituximab Fab fragment
Species: homo sapiens, mus musculus
- Chain 'L':
Compound: light chain of the Rituximab Fab fragment
Species: homo sapiens, mus musculus
Domains in SCOP 1.75: d2osll1, d2osll2 - Chain 'P':
Compound: B-lymphocyte antigen CD20
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'Q':
Compound: B-lymphocyte antigen CD20
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2oslB (B:)
qivlsqspailsaspgekvtmtcrasssvsyihwfqqkpgsspkpwiyatsnlasgvpvr
fsgsgsgtsysltisrveaedaatyycqqwtsnpptfgggtkleikrtvaapsvfifpps
deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
skadyekhkvyacevthqglsspvtksfnrgec
- Chain 'H':
No sequence available.
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>2oslL (L:)
qivlsqspailsaspgekvtmtcrasssvsyihwfqqkpgsspkpwiyatsnlasgvpvr
fsgsgsgtsysltisrveaedaatyycqqwtsnpptfgggtkleikrtvaapsvfifpps
deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
skadyekhkvyacevthqglsspvtksfnrgec
- Chain 'P':
No sequence available.
- Chain 'Q':
No sequence available.