PDB entry 2osl

View 2osl on RCSB PDB site
Description: Crystal structure of Rituximab Fab in complex with an epitope peptide
Class: Immune System
Keywords: Fab-peptide complex, Rituximab, chimeric antibody
Deposited on 2007-02-06, released 2007-04-10
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: heavy chain of the Rituximab Fab fragment
  Species: homo sapiens, mus musculus
  
• Chain 'B':
  Compound: light chain of the Rituximab Fab fragment
  Species: homo sapiens, mus musculus
  Domains in SCOP 1.73: d2oslb1, d2oslb2
• Chain 'H':
  Compound: heavy chain of the Rituximab Fab fragment
  Species: homo sapiens, mus musculus
  
• Chain 'L':
  Compound: light chain of the Rituximab Fab fragment
  Species: homo sapiens, mus musculus
  Domains in SCOP 1.73: d2osll1, d2osll2
• Chain 'P':
  Compound: B-lymphocyte antigen CD20
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11836
• Chain 'Q':
  Compound: B-lymphocyte antigen CD20
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11836
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oslB (B:)
  qivlsqspailsaspgekvtmtcrasssvsyihwfqqkpgsspkpwiyatsnlasgvpvr
  fsgsgsgtsysltisrveaedaatyycqqwtsnpptfgggtkleikrtvaapsvfifpps
  deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
  skadyekhkvyacevthqglsspvtksfnrgec
  

  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oslL (L:)
  qivlsqspailsaspgekvtmtcrasssvsyihwfqqkpgsspkpwiyatsnlasgvpvr
  fsgsgsgtsysltisrveaedaatyycqqwtsnpptfgggtkleikrtvaapsvfifpps
  deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
  skadyekhkvyacevthqglsspvtksfnrgec
  

  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.