PDB entry 2or9

View 2or9 on RCSB PDB site
Description: The structure of the anti-c-myc antibody 9E10 Fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops
Class: immune system
Keywords: ANTIGEN-ANTIBODY COMPLEX, ANTIGEN RECOGNITION, myc-tag, long CDR H3, IMMUNE SYSTEM
Deposited on 2007-02-02, released 2008-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-01-20, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.252
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Monoclonal anti-c-myc antibody 9E10
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2OR9 (0-End)
    Domains in SCOPe 2.07: d2or9h1
  • Chain 'I':
    Compound: Monoclonal anti-c-myc antibody 9E10
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2OR9 (0-227)
    Domains in SCOPe 2.07: d2or9i1
  • Chain 'L':
    Compound: Monoclonal anti-c-myc antibody 9E10
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2OR9 (0-End)
  • Chain 'M':
    Compound: Monoclonal anti-c-myc antibody 9E10
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2OR9 (0-217)
  • Chain 'P':
    Compound: synthetic epitope peptide of 9E10
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2OR9 (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2or9H (H:)
    evhlvesggdlvkpggslklscaasgftfshygmswvrqtpdkrlewvatigsrgtythy
    pdsvkgrftisrdndknalylqmnslksedtamyycarrsefyyygntyyysamdywgqg
    asvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtf
    pavlqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2or9H (H:)
    evhlvesggdlvkpggslklscaasgftfshygmswvrqtpdkrlewvatigsrgtythy
    pdsvkgrftisrdndknalylqmnslksedtamyycarrsefyyygntyyysamdywgqg
    asvtvssakttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2or9I (I:)
    evhlvesggdlvkpggslklscaasgftfshygmswvrqtpdkrlewvatigsrgtythy
    pdsvkgrftisrdndknalylqmnslksedtamyycarrsefyyygntyyysamdywgqg
    asvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtf
    pavlqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'P':
    No sequence available.