PDB entry 2or7

View 2or7 on RCSB PDB site
Description: Tim-2
Class: immune system
Keywords: Beta barrel, immunoglobulin fold, IgV domain, TIM, IMMUNE SYSTEM
Deposited on 2007-02-02, released 2007-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Timd2, Tim2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R183 (Start-110)
      • see remark 999 (61)
      • cloning artifact (111)
    Domains in SCOPe 2.06: d2or7a1, d2or7a2
  • Chain 'B':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Timd2, Tim2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R183 (1-110)
      • initiating methionine (0)
      • see remark 999 (61)
      • cloning artifact (111-114)
    Domains in SCOPe 2.06: d2or7b1, d2or7b2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2or7A (A:)
    meshtavqglaghpvtlpciysthlggivpmcwglgecrhsycirsliwtngytvthqrn
    sryqlkgnisegnvsltientvvgdggpyccvveipgafhfvdymlevkpelvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2or7A (A:)
    avqglaghpvtlpciysthlggivpmcwglgecrhsycirsliwtngytvthqrnsryql
    kgnisegnvsltientvvgdggpyccvveipgafhfvdymlevkpel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2or7B (B:)
    meshtavqglaghpvtlpciysthlggivpmcwglgecrhsycirsliwtngytvthqrn
    sryqlkgnisegnvsltientvvgdggpyccvveipgafhfvdymlevkpelvpr