PDB entry 2oqy

View 2oqy on RCSB PDB site
Description: The crystal structure of muconate cycloisomerase from Oceanobacillus iheyensis
Class: isomerase
Keywords: enolase superfamily, structural genomics, Target 9375a, NYSGRC, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE
Deposited on 2007-02-01, released 2007-03-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis [TaxId:182710]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oqya1, d2oqya2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis [TaxId:182710]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oqyb1, d2oqyb2
  • Chain 'C':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis [TaxId:182710]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oqyc1, d2oqyc2
  • Chain 'D':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis [TaxId:182710]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oqyd1, d2oqyd2
  • Chain 'E':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis [TaxId:182710]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oqye1, d2oqye2
  • Chain 'F':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis [TaxId:182710]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oqyf1, d2oqyf2
  • Chain 'G':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis [TaxId:182710]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oqyg1, d2oqyg2
  • Chain 'H':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis [TaxId:182710]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2oqyh1, d2oqyh2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oqyA (A:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqyA (A:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlsw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oqyB (B:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqyB (B:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlsw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oqyC (C:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqyC (C:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlsw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2oqyD (D:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqyD (D:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlsw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2oqyE (E:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqyE (E:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlsw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2oqyF (F:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqyF (F:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlsw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2oqyG (G:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqyG (G:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlsw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2oqyH (H:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqyH (H:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlsw