PDB entry 2oqo

View 2oqo on RCSB PDB site
Description: Crystal structure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis
Class: transferase
Keywords: transferase
Deposited on 2007-01-31, released 2007-03-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding protein 1A (PBP-1a) (PBP1a)
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: mrcA, ponA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2oqoa1
  • Heterogens: EPE, CPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oqoA (A:)
    gpgyqdpkgrlygtigiqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraai
    vnyragrivqggstitqqlaknlfltrertlerkikeallaikiertfdkkkimelylnq
    iylgsgaygveaaaqvyfgkhvwelsldeaallaalpkapakynpfyhperalqrrnlvl
    krmleegyitpeqyeeavnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqoA (A:)
    tigiqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivnvqggstitqql
    aknlfltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvyfg
    khvwelsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeeavn
    k