PDB entry 2oqj

View 2oqj on RCSB PDB site
Description: Crystal structure analysis of Fab 2G12 in complex with peptide 2G12.1
Class: Immune system
Keywords: immunoglobulin fold, Immune system
Deposited on 2007-01-31, released 2008-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fab 2G12 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6PIH4 (2-210)
• Chain 'B':
  Compound: Fab 2G12 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6N089 (0-223)
  Domains in SCOPe 2.05: d2oqjb1, d2oqjb2
• Chain 'C':
  Compound: peptide 2G12.1 (ACPPSHVLDMRSGTCLAAEGK)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2OQJ (0-End)
• Chain 'D':
  Compound: Fab 2G12 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6PIH4 (2-210)
• Chain 'E':
  Compound: Fab 2G12 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6N089 (0-223)
  Domains in SCOPe 2.05: d2oqje1, d2oqje2
• Chain 'F':
  Compound: peptide 2G12.1 (ACPPSHVLDMRSGTCLAAEGK)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2OQJ (0-End)
• Chain 'G':
  Compound: Fab 2G12 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6PIH4 (2-210)
• Chain 'H':
  Compound: Fab 2G12 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6N089 (0-223)
  Domains in SCOPe 2.05: d2oqjh1, d2oqjh2
• Chain 'I':
  Compound: peptide 2G12.1 (ACPPSHVLDMRSGTCLAAEGK)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2OQJ (0-End)
• Chain 'J':
  Compound: Fab 2G12 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6PIH4 (2-210)
• Chain 'K':
  Compound: Fab 2G12 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6N089 (0-223)
  Domains in SCOPe 2.05: d2oqjk1, d2oqjk2
• Chain 'L':
  Compound: peptide 2G12.1 (ACPPSHVLDMRSGTCLAAEGK)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2OQJ (0-End)

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oqjB (B:)
  evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
  adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
  vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
  qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oqjE (E:)
  evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
  adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
  vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
  qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oqjH (H:)
  evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
  adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
  vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
  qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
  

  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oqjK (K:)
  evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
  adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
  vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
  qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
  

  
  
• Chain 'L':
  No sequence available.