PDB entry 2opx

View 2opx on RCSB PDB site
Description: Crystal Structure of Lactaldehyde Dehydrogenase from Escherichia coli
Class: oxidoreductase
Keywords: Rossmann fold; Dehydrogenase; deoxycholate; Protein detergent complex, OXIDOREDUCTASE
Deposited on 2007-01-30, released 2007-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.177
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde dehydrogenase A
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2opxa_
  • Heterogens: DXC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2opxA (A:)
    msvpvqhpmyidgqfvtwrgdawidvvnpateavisripdgqaedarkaidaaeraqpew
    ealpaieraswlrkisagirerateisaliveeggkiqqlaevevaftadyidymaewar
    ryegeiiqsdrpgenillfkralgvttgilpwnfpffliarkmapalltgntivikpsef
    tpnnaiafakivdeiglprgvfnlvlgrgetvgqelagnpkvamvsmtgsvsagekimat
    aaknitkvclelggkapaivmddadlelavkaivdsrvinsgqvcncaervyvqkgiydq
    fvnrlgeamqavqfgnpaerndiamgplinaaalerveqkvaraveegarvalggkaveg
    kgyyypptllldvrqemsimheetfgpvlpvvafdtleeaismandsdygltssiytqnl
    nvamkaikglkfgetyinrenfeamqgfhagwrksgiggadgkhglheylqtqvvylqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2opxA (A:)
    vpvqhpmyidgqfvtwrgdawidvvnpateavisripdgqaedarkaidaaeraqpewea
    lpaieraswlrkisagirerateisaliveeggkiqqlaevevaftadyidymaewarry
    egeiiqsdrpgenillfkralgvttgilpwnfpffliarkmapalltgntivikpseftp
    nnaiafakivdeiglprgvfnlvlgrgetvgqelagnpkvamvsmtgsvsagekimataa
    knitkvclelggkapaivmddadlelavkaivdsrvinsgqvcncaervyvqkgiydqfv
    nrlgeamqavqfgnpaerndiamgplinaaalerveqkvaraveegarvalggkavegkg
    yyypptllldvrqemsimheetfgpvlpvvafdtleeaismandsdygltssiytqnlnv
    amkaikglkfgetyinrenfeamqgfhagwrksgiggadgkhglheylqtqvvylqs