PDB entry 2opa

View 2opa on RCSB PDB site
Description: YwhB binary complex with 2-Fluoro-p-hydroxycinnamate
Class: isomerase
Keywords: homohexamer, 4-Oxalocrotonate Tautomerase, inhibitor, 2-Fluoro-p-Hydroxycinnamate, ISOMERASE
Deposited on 2007-01-28, released 2008-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable tautomerase ywhB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ywhB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2opaa_
  • Chain 'B':
    Compound: Probable tautomerase ywhB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ywhB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2opab_
  • Heterogens: FHC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2opaA (A:)
pyvtvkmlegrtdeqkrnlvekvteavkettgaseekivvfieemrkdhyavagkrlsdm
e

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2opaB (B:)
pyvtvkmlegrtdeqkrnlvekvteavkettgaseekivvfieemrkdhyavagkrlsdm
e