PDB entry 2op4

View 2op4 on RCSB PDB site
Description: Crystal Structure of Quorum-Quenching Antibody 1G9
Class: immune system
Keywords: Immunoglobulin, antibody, Fab, induced fit, quorum sensing, homoserine lactone, IMMUNE SYSTEM
Deposited on 2007-01-26, released 2007-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.203
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Murine Antibody Fab RS2-1G9 IGG1 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OP4 (0-221)
  • Chain 'L':
    Compound: Murine Antibody Fab RS2-1G9 Lambda Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OP4 (0-211)
    Domains in SCOPe 2.06: d2op4l1, d2op4l2
  • Heterogens: EDO

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2op4L (L:)
    qavvtqesalttspgetvtltcrsstgavttrnyanwvqekpdhfftgligdtnnrapgv
    parfsgslighkaaltitgaqtedesvyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltagawerhssyscqvtheghtvekslsra