PDB entry 2op2

View 2op2 on RCSB PDB site
Description: Crystal structure of RNase double-mutant V43C R85C with extra disulphide bond
Class: hydrolase
Keywords: RNASE, folding, HYDROLASE
Deposited on 2007-01-26, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-123)
      • engineered (42)
      • engineered (84)
    Domains in SCOPe 2.07: d2op2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2op2A (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpcntfvhesladvqavcsq
    knvackngqtncyqsystmsitdccetgsskypncaykttqankhiivacegnpyvpvhf
    dasv