PDB entry 2oox

View 2oox on RCSB PDB site
Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with AMP
Class: transferase
Keywords: AMPK, kinase, AMP, crystal structure
Deposited on 2007-01-26, released 2007-02-06
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SNF1-like protein kinase ssp2
    Species: Schizosaccharomyces pombe
    Gene: ssp2, SPCC74.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ooxa1
  • Chain 'B':
    Compound: SPCC1919.03c protein
    Species: Schizosaccharomyces pombe
    Gene: SPCC1919.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ooxb1
  • Chain 'C':
    Compound: SNF1-like protein kinase ssp2
    Species: Schizosaccharomyces pombe
    Gene: ssp2, SPCC74.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ooxc1
  • Chain 'D':
    Compound: SPCC1919.03c protein
    Species: Schizosaccharomyces pombe
    Gene: SPCC1919.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ooxd1
  • Chain 'E':
    Compound: Hypothetical protein C1556.08c in chromosome I
    Species: Schizosaccharomyces pombe
    Gene: SPAC1556.08c, SPAC1F12.01c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10343 (1-332)
      • cloning artifact (0)
    Domains in SCOP 1.75: d2ooxe1, d2ooxe2
  • Chain 'G':
    Compound: Hypothetical protein C1556.08c in chromosome I
    Species: Schizosaccharomyces pombe
    Gene: SPAC1556.08c, SPAC1F12.01c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10343 (1-End)
      • cloning artifact (0)
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ooxA (A:)
    sqstrkksrrnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiks
    rweiphckregkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkss
    fpfldlcamlvcklfsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ooxA (A:)
    rnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphckr
    egkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlcam
    lvcklfsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ooxB (B:)
    mseseqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvl
    lnhlaaantqlgvlalsattryhrkyvttamfknfdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ooxB (B:)
    seqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnh
    laaantqlgvlalsattryhrkyvttamfknfd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ooxC (C:)
    sqstrkksrrnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiks
    rweiphckregkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkss
    fpfldlcamlvcklfsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ooxC (C:)
    rrnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphck
    regkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlca
    mlvcklfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ooxD (D:)
    mseseqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvl
    lnhlaaantqlgvlalsattryhrkyvttamfknfdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ooxD (D:)
    seqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnh
    laaantqlgvlalsattryhrkyvttamfknfd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ooxE (E:)
    mdvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsaplw
    dseankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippetiy
    vhpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketamlr
    vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli
    qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle
    gilsladilnyiiydktttpgvpeqtdnfesav
    

  • Chain 'G':
    No sequence available.