PDB entry 2oot

View 2oot on RCSB PDB site
Description: A High Resolution Structure of Ligand-free Human Glutamate Carboxypeptidase II
Class: hydrolase
Keywords: metallopeptidase, folate hydrolase, prostate-specific membrane antigen, Naaladase, GCPII, HYDROLASE
Deposited on 2007-01-26, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oota1, d2oota2, d2oota3
  • Heterogens: NAG, BMA, MAN, ZN, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ootA (A:)
    rskssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwk
    efgldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppf
    safspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlag
    akgvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrr
    giaeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqk
    vkmhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrs
    fgtlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnyt
    lrvdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndf
    evffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrg
    gmvfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfte
    iaskfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkya
    gesfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ootA (A:)
    khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
    vllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdl
    vyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpady
    fapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipv
    hpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtr
    iynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprr
    tilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslv
    hnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgr
    arytkngyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpfdcrdya
    vvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfnpivlrmm
    ndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdieskvdpska
    wgevkrqiyvaaftvqaaaetlseva