PDB entry 2ons

View 2ons on RCSB PDB site
Description: Crystal structure of A. fulgidus periplasmic binding protein ModA with bound tungstate
Class: ligand binding protein
Keywords: soluble protein 2, LIGAND BINDING PROTEIN
Deposited on 2007-01-24, released 2007-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.186
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0100 protein AF_0094
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Gene: AF_0094
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30142 (3-313)
      • cloning artifact (0-2)
    Domains in SCOPe 2.05: d2onsa_
  • Heterogens: WO4, MG, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2onsA (A:)
ghmnvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadvia
tadytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfs
npnddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsseriein
kskimirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskv
kvvlangkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppra
dtavpslkamvevs