PDB entry 2ons

View 2ons on RCSB PDB site
Description: Crystal structure of A. fulgidus periplasmic binding protein ModA with bound tungstate
Class: ligand binding protein
Keywords: soluble protein 2
Deposited on 2007-01-24, released 2007-03-06
The last revision prior to the SCOP 1.75 freeze date was dated 2007-03-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.186
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0100 protein AF_0094
    Species: Archaeoglobus fulgidus
    Gene: AF_0094
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30142 (3-313)
      • cloning artifact (0-2)
    Domains in SCOP 1.75: d2onsa1
  • Heterogens: WO4, MG, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2onsA (A:)
    ghmnvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadvia
    tadytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfs
    npnddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsseriein
    kskimirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskv
    kvvlangkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppra
    dtavpslkamvevs