PDB entry 2onl

View 2onl on RCSB PDB site
Description: Crystal Structure of the p38a-MAPKAP kinase 2 Heterodimer
Class: transferase
Keywords: heterodimer, kinase, NLS, NES, docking groove, TRANSFERASE
Deposited on 2007-01-24, released 2007-02-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.315
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2onla1
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2onlb1
  • Chain 'C':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2onlc1
  • Chain 'D':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2onld1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2onlA (A:)
    gshmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onlA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglartrwyrapeim
    lnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisses
    arnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdp
    ddepvadpydqsfesrdllidewksltydevisfvppp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2onlB (B:)
    gshmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onlB (B:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglaratrwyrapei
    mlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisse
    sarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhd
    pddepvadpydqsfesrdllidewksltydevisfvppp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2onlC (C:)
    gshmlemlsnsqgqsppvpfpapapppqpptpalphppaqppppppqqfpqfhvksglqi
    kknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqc
    phivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeai
    qylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapev
    lgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsev
    seevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvke
    emtsalatmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onlC (C:)
    fhvksglqikknaiiddykvkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcph
    ivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqy
    lhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlg
    pekydkscdmwslgvimyillcgyppfyefpnpewsevseevkmlirnllkteptqrmti
    tefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmrvdyeqikikkie
    dasnplllkrrkkaral
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2onlD (D:)
    gshmlemlsnsqgqsppvpfpapapppqpptpalphppaqppppppqqfpqfhvksglqi
    kknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqc
    phivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeai
    qylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapev
    lgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsev
    seevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvke
    emtsalatmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onlD (D:)
    fhvksglqikknaiiddvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcphivri
    vdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqylhsi
    niahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlgpeky
    dkscdmwslgvimyillcgyppfyefpnpewsevseevkmlirnllkteptqrmtitefm
    nhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmrvdyeqikikkiedasn
    plllkrrkkaral