PDB entry 2oni

View 2oni on RCSB PDB site
Description: Catalytic Domain of the Human NEDD4-like E3 Ligase
Class: ligase
Keywords: ALPHA and BETA PROTEIN (a + b), E3 LIGASE, HECT DOMAIN, UBL-CONJUGATION PATHWAY, STRUCTURAL GENOMICS CONSORTIUM, SGC, LIGASE
Deposited on 2007-01-24, released 2007-04-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase NEDD4-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD4L, KIAA0439, NEDL3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96PU5 (18-End)
      • cloning artifact (13-17)
      • modified residue (44)
      • modified residue (60)
      • modified residue (99)
      • modified residue (162-163)
      • modified residue (173)
      • modified residue (198)
      • modified residue (222)
      • modified residue (248)
      • modified residue (276)
      • modified residue (314)
      • modified residue (334)
      • modified residue (387)
    Domains in SCOPe 2.03: d2onia_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oniA (A:)
    mhhhhhhssgrenlyfqgsrefkqkydyfrkklkkpadipnrfemklhrnnifeesyrri
    msvkrpdvlkarlwiefesekgldyggvarewffllskemfnpyyglfeysatdnytlqi
    npnsglcnedhlsyftfigrvaglavfhgklldgffirpfykmmlgkqitlndmesvdse
    yynslkwilendpteldlmfcideenfgqtyqvdlkpngseimvtnenkreyidlviqwr
    fvnrvqkqmnaflegftellpidlikifdenelellmcglgdvdvndwrqhsiykngycp
    nhpviqwfwkavllmdaekrirllqfvtgtsrvpmngfaelygsngpqlftieqwgspek
    lprahtcfnrldlppyetfedlrekllmaven
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oniA (A:)
    lyfqgsrefkqkydyfrkklkkpadipnrfemklhrnnifeesyrrimsvkrpdvlkarl
    wiefeekgldyggvarewffllskemfnpyyglfeysatdnytlqinpnsglcnedhlsy
    ftfigrvaglavfhgklldgffirpfykmmlgkqitlndmesvdseyynslkwilendpt
    eldlmfcideenfgqtyqvdlkpngseimvtnenkreyidlviqwrfvnrvqkqmnafle
    gftellpidlikifdenelellmcglgdvdvndwrqhsiykngycpnhpviqwfwkavll
    mdaekrirllqfvtgtsrvpmngfaelygsngpqlftieqwgspeklprahtcfnrldlp
    pyetfedlrekllmave